Benefit Cosmetics LLC

Archive for the ‘Hot New Doses’ Category

Get Wicked This Valentine’s: Eat, Play & Love

Sunday, February 7th, 2010

Learn the language of love when playing cheek to cheek in this 5 pack of  Kiki De Montparnasse’s imprinted French lesson cotton jersey panties, outlined in sheer lace. Each kit includes five erotic lessons: mange-moi (eat me), baise-moi (fuck me), aime-moi (love me), fesse-moi (spank me), attache-moi (tie me up). French Lesson Panty Set, $250

Bring out your inner fantasy with these position dice. Last Licks Passionate Positions Dice Game, $13.50

Who doesn’t like the warmth of chocolate…Dabble alittle over your partners body for a decadent feast Desserts on Me Chocolate Body Paint, $14.50

 Have some bondage four play while grasping each others’ wrists with leather, silk and tie cuffs  Kiki De Montparnasse, $175

Sop’s First Give-Away

Saturday, February 6th, 2010

Hi everybody this will be my first monthly give-away for a chance to win this Cute, faux-leather, Grey fringe bag. If you have awesome style or just purchased some uber fab shoes, we here at SOP want to see. Simply email a photo and at the end of the month a winner will be chosen. You must leave all required info such as name, address, email, pictures (required) when entering to info@spoonfulofperfection.com

Last date to enter: March 1st, 2010 – Prize mailed out 2 weeks after entry date

Thanks for entering!

Dani & Nat B

Why Does Leather Make You Feel So Naughty?

Tuesday, February 2nd, 2010

This leather cut-out wing hand, and arm bird & flight cuff  motif’s are a pretty accessory with a romantic yet edgy feel. If you want to add a touch of rock to your outfit try the Leather Love Cuff.

Editor:Dani

Jay-Z Sports A Louis Vuitton Murse

Monday, February 1st, 2010

jayz_lvbackpack

Louis Vuitton Ostrich Skin Backpack

Jay-Z, husband of Beyonce is known for his stylish urban attire. Paparazzi spotted him exiting the Crillon Hotel in Paris sportin’ this rare, straight off the men’s Spring 2010 runway, Louis Vuitton Ostrich Skin, oversized Monogram “Christopher” backpack. It features a easy-access handle design and buckles, built-in towel holder at the base, roomy pockets within and a drawstring closure to keep your valuables secure.

Backpacks are no longer for pre-adolescents, especially at a hefty tag of $24,900. @ select Louis Vuitton boutiques 866-VUITTON

Louis-Vuitton-Ostrich-Skin-Backpack

SOP Gets Bitten By Gucci Techno Horsebit Flap Bag

Tuesday, January 26th, 2010

240237_a7m0n_9014_001_zoom

I just got bit by Gucci’s Techno Horsebit Flap Bag. The shiny nickel hardware and detailed stitching with panels in different directions, three handles, one regular woven and two detachable shoulder straps are great for everyday wear. Not to mention, White and neutral colored purses are in this season and you must get one. gucci.com

Editor:Dani

The Colorful World Of Alice In Wonderland

Monday, January 25th, 2010

Disney’s Alice in Wonderland, Tim Burton and Urban Decay has launched a limited edition 3D pallette of 16 eyeshadows, travel sizes of Eye Primer Potion and two 24/7 Eye Pencils called the  ”Book of Shadow’s” with names like White Rabbit, Jabberwocky and Oraculum. The palette reveals a pop-up scene of Alice in the mushroom forest, staggering past towering mushrooms and a hookah-smoking caterpillar with a large mirror resting behind the scene. How Cute! 

book of shadows

 

OPI Nail Polish also has a Limited Edition of shades inspired by Alice in Wonderland that’s sure to grab your attention. The four colors consist of these awesome names such as “Off With Her Red!, Mad As A Hatter (a cool, multi-color glitter shade!), Absolutely Alice, and Thanks So Muchness!  They retail at 8.50 ea. or you can try all the colors and purchase a mini collection at  amazon.com.

opi-alice-in-wonderland-collection

If you like OPI colors that are a little more subtle try there “Fairytale Bride” collection and or “Espana coleccion de espana”. Movie in theaters 3/5/10

Editor:Dani

The Addiction Of The Side Shave

Tuesday, January 12th, 2010

We have many celebs shaving the side of their hair like, Fantasia, Willow(Will & Jada Smiths daughter), Rihanna, La La and Cassie to name a few.

Do we love or hate this new trend?

tbozwillowrihannaevacassiemissyfantasiaj daveykelislala

 

Editor:Dani

The Karate Kid Trailer

Friday, December 25th, 2009

SOP is so excited to see the new revamped Karate Kid Movie Movie Starring Jaden Smith (Will Smith’s son)  Taraji Henson & Jackie Chan.

Editor: Dani

Cat Burglar Barbie By Christian Louboutin!

Sunday, December 6th, 2009

icon icon 

 How cute is  the new Christian Louboutin Barbie, Anything with his name attached I just love. And how much do you love her cat suit? I’m still a kid at heart so grab this Barbie by Christian Louboutin $150

Editor:Dani

5 Things He may need as much as YOU!

Sunday, November 22nd, 2009

tyno2

So,I wanted to change the pace of things just a lil bit’…

A Lil’ sexy: Throw on your red dress, slip on your high heels,
and some of that sweet perfume.(In the words of Johnny Gill)..
This will change up the atmosphere and add a lil' sexiness
to your love making… 
 
Showim’ whatcha’ working with: If you have a mirror on
the wall,closet or better yet video camera...USE IT…
If you have a mirror position yourself to be seen,
men are very visual and would love to see you enjoying every
minute. As for the video camera, No need to record,
plug it into your TV for visuals only. Now if you want a
 Paris or Kim Flick press record…and just lay back & watch 
the magic later!    
Say what u really wanna say: Talk to him, let him know what
you want,be loud about it… Believe me, he will respond with
 no complaints. Don’t be afraid to ask him what he wants, you
maybe surprised and have the best time of your sex life. But,
make sure you're open to the answer and remember you’re both
most vulnerable during this sensually time!
Toys R Us:  Get a couple props that make you feel good and
remember,if it feels good to you then he’ll get the point
and try to make it feel even better. You may want to have
the conservation in  advance, very casually one day before
actually making a purchase. If he’s comfortable and shows
an interest… Ladies that means let’s  go shopping for some
bedroom toys... Make sure to listen carefully
to what turns him on.. as well as you!
It pay’s to be the Boss: You can use your toys while being the
boss lady.
Tell him to lie down while you blind fold or hand cuff him,
or whatever you choose. Tease him with licks, nibbles, caresses,
but whatever you do don’t let him take control until you’re nice
and ready.Ladies you know exactly what I mean… Scratch
his chest while on-top, or yank his head toward you to
 give him a passionate,this-is-what-I-do kind of kiss.
He’ll be ready to take charge when your ready to demote
yourself from Boss Lady… to lil' miss submissive;)
Editor: Nat B